SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366522 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366522
Domain Number 1 Region: 919-1110
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.92e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00082
Further Details:      
 
Domain Number 2 Region: 61-97
Classification Level Classification E-value
Superfamily WW domain 0.00000727
Family WW domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366522
Sequence length 1115
Comment ARHGAP39 (Homo_sapiens) Rho GTPase activating protein 39
Sequence
MSQTQDYECRSHHVDGQESRIPGSSTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR
IKRTSEDQWWELFDPNTSRFYYYSAASQRTVWHRPQNCDIIPLAKLQTLKQNTEFPRASA
DSSPGRGSRRGSREGSTGSSLEPDAVTERVQELPARAGRQVALGSAREESSSSSPPGMLL
EKDCEVYRDYSVDGQLLHYRTSSLRWNSGTKERMLIKVPDREPSFLAPQGNGYPLEGQPG
GRPRRPSGSQHSPNLQTFTSDADGTVFFPERRPSPFLRRAELPGSCSPMLAQSRKASSDS
QPSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDMQFEVSGPYQAGSPQRSPGRKPRPFLPT
TKQAPASPCQQLVRTKQRCPERFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRSGPRHKYA
PNPGGGSYSLQPSPCLLRDQRLGILSGDYSTMEGPEPRHSQLPTPLPQAQEDAMSWSSQQ
DTMSSTGYSPGTRKRKSRKPSLCQAPSTSADGPGDLMSEQPLAEEHSPCGPSLAQVKRAE
AEADAARGAAEPFLAQARLAWEAQQVHFHMKQRGSWDSQQDGSGYESDGAVPLPMPGPVV
RAFSEDEALAQQESKHWKRGTFEKLGFPQVLLEKSSVSVQTNLASPEPYLHPSQSEDLGA
CAQFESSRQNRNAVPSSSCVFPTFTLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANM
LAWSSESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSMQG
LRDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDT
KVTQHIKELLERNTKKKSKLRKKPKPYVEELDGVAISTYAKYCYHKLQKAALTGAKKGLK
KPNVEEIRHAKNAVFSPSMFGSSLQEIMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTE
GIFRVPGDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIA
HYESPEAAVAVVHALPRINRMVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRC
QSDDPRVIFENTRKEMSFLRVLIQNLDTSFMEGVL
Download sequence
Identical sequences G5C5R2
HGL_H00000366522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]