SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366565 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366565
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.92e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 125-183
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 8.63e-20
Family VPS28 C-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366565
Sequence length 183
Comment VPS28 (Homo_sapiens) vacuolar protein sorting 28 homolog (S. cerevisiae)
Sequence
MFHGIPATPGMGVPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQW
Download sequence
Identical sequences G5C5S4
HGL_H00000366565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]