SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366604 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366604
Domain Number 1 Region: 98-217
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.81e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  HGL_H00000366604
Domain Number - Region: 237-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000244
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366604
Sequence length 511
Comment SF1 (Homo_sapiens) splicing factor 1
Sequence
MLVLKFWVQLILLPELLQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTR
EFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLI
GPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKK
AVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTT
VCTKCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPAT
TPLASAPRPAAPANNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSF
PHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVG
SGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSM
ASSTPLPWQQRSLPAAAMARAMRVRTFRAHW
Download sequence
Identical sequences G5B6N9
HGL_H00000366604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]