SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366636 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366636
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 2 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.42e-20
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366636
Sequence length 194
Comment ZNF184 (Homo_sapiens) zinc finger protein 184
Sequence
SVTFKDVVVDFTQEEWKQLDPGQRDLFRDVTLENYTHLVSIGLQVSKPDVISQLEQGTEP
WTVEPGPGVAVGACGGRQQMPPRKKLQVTEKTAPVWERGPANTEFEKSSVHSHAVTQRET
SPGQTSAKTGVKQNSPPVKKEKSCKCNECGKAFNYCSALIRHQRTHTGEKPYKCNECEKA
FSRSENLINHQRIH
Download sequence
Identical sequences G5BSF2
HGL_H00000366636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]