SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366746 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366746
Domain Number 1 Region: 54-190
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.84e-48
Family VHS domain 0.00013
Further Details:      
 
Domain Number 2 Region: 242-312
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-22
Family SH3-domain 0.0000868
Further Details:      
 
Weak hits

Sequence:  HGL_H00000366746
Domain Number - Region: 356-427
Classification Level Classification E-value
Superfamily GAT-like domain 0.0251
Family GAT domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366746
Sequence length 590
Comment STAM (Homo_sapiens) signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
Sequence
MLRAGAYQAALLLPPPPPLLPRLLGVDERWSCRGPGGSLRTPRQSVEMPLFATNPFDQDV
EKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACV
SNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIK
NLKEQGVTFPAIGSQAAEQAKASPALIAKDPGTVANKKEEEDLAKAIELSLKEQRQQTTT
LSTLYPSTSNLLTNHQHDGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETH
QGIGLFPSNFVTADLTAEXXXEPEMIKTEKKTVQFSDDVQVEMIEPEPEATFIDEDKMDQ
LLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSEFSELNVKVMEALS
LYTKLMNEDPMYSMYAKLQNQQYYMQSSGVSGAQVCPGPPQSGAYLVAGSAQMSHLHSYS
LPPEQLSSLSQGAVPPPTSPALPSQQTTASYPNAMVSSVQGTTYPNQAAMYSPPPAAAAA
AADVTVYQSAGTGMSQVPNYTLTSSALPQPGASQQPPPPQQQLYSQKALL
Download sequence
Identical sequences HGL_H00000366746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]