SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366898 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366898
Domain Number 1 Region: 233-333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000778
Further Details:      
 
Domain Number 2 Region: 85-138
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000236
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.045
Further Details:      
 
Domain Number 3 Region: 6-62
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000602
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366898
Sequence length 658
Comment HIF3A (Homo_sapiens) hypoxia inducible factor 3, alpha subunit
Sequence
RSSTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHR
LCAAGEWNQVGAKGEPLDACYLKALEGFVMVLTTEGDMAYLSENVSKHLGLSQLELIGHS
IFDFVHPCDQEELQDALTPRPSLSKKKPEAPTQRCFSLRMKSTLTSRGRTLNLKAATWKV
LHCSGHMRAYKSSGQPALAGNPSSEPPLQCLVLICEAIPHPGNLEPPLGRGAFLTRHSLD
MKFTYCDERIAEVAGYSPDDLIGCSAYEYIHALDSDAVSRSIHTLLSKGQAVTGQYRFLA
RSGGYLWTQTQATVVSGGRGPQSESIICVHFLISRVEETGVVLSLEQTERHSRRPLQRGT
SSQKDGPNPGDRLDTPGPWILAFLHPPALSEATLAADPRRFCSPDLRRLLAPILDGAAVA
TTPSTPQAAWRPRSPLAADLPDELLVGMERIHRLGAAGKNPEAEDTDLNIASDADALDLE
MLAPYISMDDDFQLSSSEQLPRAFHRPPGTVPRPRAQSFHGLSPPTPEPAPLPRWGSDPR
LSCSSPPRGDPSASSYTVGARKRALAQSSEDEGVDLLGVRPPKRSPSLDPENFLLPPVSL
SFLLMGGQAPGIQQDPHTHFLDMDEPLGLGPSLLSLYPDEDAAQPRSHFVPAAGLAQA
Download sequence
Identical sequences G5AUZ0
HGL_H00000366898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]