SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000367830 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000367830
Domain Number 1 Region: 270-348,379-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-45
Family Protein kinases, catalytic subunit 0.0000216
Further Details:      
 
Domain Number 2 Region: 456-556
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-41
Family Protein kinases, catalytic subunit 0.0000227
Further Details:      
 
Domain Number 3 Region: 47-127
Classification Level Classification E-value
Superfamily CAD & PB1 domains 6.21e-19
Family PB1 domain 0.0000999
Further Details:      
 
Domain Number 4 Region: 137-206
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.63e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0051
Further Details:      
 
Domain Number 5 Region: 567-689
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.11e-16
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000367830
Sequence length 794
Comment PRKCZ (Homo_sapiens) protein kinase C, zeta
Sequence
MSCVLWEALGVLATTTVQDLIPRWPGSDREELMLTQGPGSLCLLIPSRDILITSVDTVMT
FHALCGEVRDMCRLDPQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQHRDEGLILHVF
PSIPERPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLSR
QGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPADEKSDGVDLPSEDTDGIAYIS
STRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQ
IYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLPSCFQRKKGPRALLALPPEG
GRAGSSMGGQVSTGLLFRWLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNF
LHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKVGFYAAEICIALNFLHERGIIYRDLKL
DNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGV
LMFEMMAGRSPFDIITDNPDMNTEDCARFSVDWWALGVLMFEMMAGRSPFDIITDNPDMN
TEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSI
DWDLGPMRAGLLGTAVSVTQPGDSVWMLAAEVAMGAVQAGPVQGAEGTQGAGSSPGLCSE
GAPVGTQLEKKQALPPFQPQISDDYGLENFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGF
EYINPLLLSTEESV
Download sequence
Identical sequences G5ATI1
HGL_H00000367830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]