SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368438-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000368438-1
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily DNA clamp 0.00000000000258
Family DNA polymerase processivity factor 0.000093
Further Details:      
 
Domain Number 2 Region: 74-109
Classification Level Classification E-value
Superfamily DNA clamp 0.000000000824
Family DNA polymerase processivity factor 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368438-1
Sequence length 111
Comment PCNAAS (Homo_sapiens) PCNA antisense RNA (non-protein coding)
Sequence
MGVNLTSVSKILKCSDNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMGLDVEQLG
IPEQEYSCVVKMPSVTLNMSADVPLVVEYKIANMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences G5B411
HGL_H00000368438-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]