SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368759 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000368759
Domain Number 1 Region: 38-114
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000591
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000368759
Domain Number - Region: 655-726
Classification Level Classification E-value
Superfamily STAT 0.0184
Family STAT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368759
Sequence length 864
Comment NEDD9 (Homo_sapiens) neural precursor cell expressed, developmentally down-regulated 9
Sequence
MERTKTVLTDHMLILNCIWDPAIPSFIKDTNTVDRNLMARALYDNVPECAEELAFRKGDI
LTVIEQNTGGLEGWWLCSLDRQGIVPGNRVKLLIGPMQETPSNHDHPTSGPMHQTFGQQK
LYQVPNSQAASRDTIYQVPPSYQNQGIYQVPTGHAAQEQQDVYQVPPSQRTTGGTNGSHL
SKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSVKGPAFSAPVGEIKA
QGVYDIPPTKGVYAIPPSACRDEAGLREKEYDFPPPMKQAGRADIRPEGVYDIPPSSAKL
GGKDLHMKYSCDGLGAAEPVARRHQSLSLHHPSPPVGQPVGPQNDAYDVPRGVQFLESPA
EASEKVNPEERDGVYDVPLHNPPDMKGSRDVVDGINRLSFSSTGSTRSNMSTSSTSSKES
SLSASPAQDKRLFLDPDSAIERLHRLQQALEMGVCSLMALVTTDWRCYSYMERHINEIRA
AVDKVELLLREYVHFAKGAVANASCLPELVLHNKMKRELQRVEDSHQILSQTSHALDECS
WSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTIHTNAETLFRLGPGTLHLKNGP
ESIMNSTECPHAGSQVQLLRPGDCKAQTHNKPMPPTMGKDQPPDCSSSNGSERSWMDDYD
YVHLQGKEEFERQQQELLEKENIIKQSKMQLEHHQLSQFQLLEQEITKPVENDISKWKPS
QNLPTTNSTVGAQDRQLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPRIFVAHSKFVI
LSAHKLVFIGDTLTRQVAAQDIRNKVMNSSNQLCEQLKTIVMATKMAALHYPSTTALQEM
VHQVTDLSRNAQLFKRSLLEMATF
Download sequence
Identical sequences G5BN55
HGL_H00000368759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]