SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368859 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000368859
Domain Number 1 Region: 217-347
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-37
Family Cap-Gly domain 0.00000502
Further Details:      
 
Domain Number 2 Region: 481-607
Classification Level Classification E-value
Superfamily Cap-Gly domain 7.33e-37
Family Cap-Gly domain 0.000058
Further Details:      
 
Domain Number 3 Region: 629-704
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.41e-28
Family Cap-Gly domain 0.0000122
Further Details:      
 
Domain Number 4 Region: 51-187
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.99e-19
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368859
Sequence length 716
Comment CLIP4 (Homo_sapiens) CAP-GLY domain containing linker protein family, member 4
Sequence
MPSDCEFSFFDPNDASCQEILFDPKTSVSELFAILRQWVPQVQQNIDLIGNEILKRGCNV
NDRDGLTDMTLLHYTCKSGAHGIGDVETAVKFAAQLIDLGADVSLRSRWTNMNALHYAAY
FDVPEVIRVILKTSKPKDVDDTCSDFNFGTALHIAAYNLCAGAVKCLLEHGANPAFRNDK
GQIPADVVPDPVDMPLEMADAAATAKEIKQMLLDAVPLSCGRSKAMLPNCDHVTSKTALS
SLGLKLGDRVVIAGQKIGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGKVQYFKCAPK
YGIFAPLSKISKAKERRKNTAHPPSSKTVPPIKPQRVDVAHITSKVNTGRGTEVTLEGLL
SSQWLPPRTMCPRGLAQEDWGAGLGSSEVEAEDTGEEQRGLMTSKKNSISESALSLPPSE
ELKTVAEKDVTLHGSISSSSSTSSLEHKQSFTKKPNASSNSKKTMSKSSSLSSRASAGLN
SSATSIANDTRGEGEPRLGDRVLVVGQRVGTIKFFGTTNFAPGYWYGIELEKPHGKNDGS
VGGVQYFSCSPRYGIFAPPSRVQRLTDSLDTLSEIASNKQNHSYPGFRRSFSTTSASSQK
EINRRNAFAKSKAALRRSWSSAAAAGGLEGSVKLHEGSHVLLTSSNEMGTVRYVGPTDFA
SGVWLGLELRSAKGRNDGTVGDKRYFTCKPNHGVLVRPSRVTYRGINGSKLVDENS
Download sequence
Identical sequences G5C2X7
HGL_H00000368859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]