SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000368994 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000368994
Domain Number 1 Region: 6-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.84e-62
Family BAR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 252-445
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000368994
Sequence length 814
Comment ARHGAP44 (Homo_sapiens) Rho GTPase activating protein 44
Sequence
MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA
EADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDV
IEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSGSLQPAGSKADALR
EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQI
KAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK
KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQEQDKRL
QALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPA
DRRQPEQARRPLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTSWVARRGSSAGRKASCAP
PSMQPPAPPAELAAPLPSPLPEQVPDSPAAAVPALSPASGGLQLAAERTSTSKSKELSPG
SGQKGSPGSGQGTVCPGTQPGTQPGTSPSQPPSDQSPHTLRKVAKKLAPIPPKVPFGQPG
TVTDQSTGQPSPVSLSPTPPSTPSPYGLSYPPGYSLASGQLSPAAAPPLASPSIFTSTLA
KSRPTPKPRQRPTLPPPQPPTVSLSASSPQSTEHPMLDGMSPGESMSTDLVHFDIPSIHI
ELGSTLRLSPLEHARRHSVTDKRDSEEESESTAL
Download sequence
Identical sequences G5BRA6
HGL_H00000368994 XP_004870793.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]