SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369257 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369257
Domain Number 1 Region: 596-736
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-47
Family PLC-like (P variant) 0.000000182
Further Details:      
 
Domain Number 2 Region: 960-1095
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-39
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 
Domain Number 3 Region: 783-913
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-35
Family PLC-like (P variant) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369257
Sequence length 1408
Comment RPGRIP1L (Homo_sapiens) RPGRIP1-like
Sequence
MSGPADETAGDLPVKDIGLNLFGVGGLQETSTSRTMKSRQAVSRVSREELEDRFLRLHEE
NILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVH
ELERQNEVLKNRLISAKQQLQIQGYRQTPYNYVQSRINTGRRKVNENASLQECSKKGIRF
QDIDVPETAQPILTKYGKSLLEEARGEIRNLENVTQSQRAQIEELEHLVDILKTQLKRKE
NEIELSLLQIREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSVMEGKFIQLQEKQRTLR
ISHDALMANGDELNMQLKEQRLKCCSLEKQLHSMTFSERRIEELQDRINDLEKERELLKE
NYDKLYNSAFSAAHEEQWMLKEQQLKVHIAQLETALKSDLTDKTEILDRLKTERDQNEKL
IQENRDLQLQYLEQKQQLDELKNRMKFFNQESDINADELSEALLLIKAQKEQKNGDLFFL
EKIDSKINKDLECSIRKLQATHAETVQELEKTRNMLIMQHKINKDYQMEVEAVTHKMENL
QQDYEFKVEQYVHLLDIRAARIQKLEAQLKDIAYGTKQYKFKPEIMPDDSVDEFDETIHL
ERGENLFEIHINKITFSSEVLQASGDKEPITFCTYAFYDFELQTTPIVRGLHPKYNFTSQ
YLVHVNDLFLQYIQKNTVTLEVHQAYSTDYETIAACQLRFHKILEKSGRIFYTASLVGTK
GDIPNFGTVEYWFQLRVPMDQAIRLYQERAKALGYITSTFKEPEQMQSLSQQVPKTAQLS
SADSTDGNLNELHITIRCCSHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSSDPQFDD
YMCFPVPMNMDLDRYLKSESLGFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGTKGDI
PNFGTVEYWFQLRVPMDQAIRLYQERAKALGYITSTFKEPEQMQSLSQQVPKTAQLSSAD
STDGNLNELHITIRCCSHLQSRASHLQPHPYVVYKFFDFADHDTAIIPSSSDPQFDDYMC
FPVPMNMDLDRYLKSESLGFYVFDDSDTQENIYIGKVNVPLISLAHDRCISGIFELTDHQ
KHPAGTIHVILKWKFAYLPPSGSVTPEDLGNFIHRKEPEIIQRLPPTSSDSIPVVAPRAK
PRQRLRPIDKKVSFVDTMPHHNSEICIPPEDMKEISPDVECTPEIDNNIPAISHIPKISQ
ESIIAKVKDNAEKTHQGKEEDISLLSEGQLAEQSLASSEDETEITEEIEPEDEEDRSASD
SDDCIIPGPLSKHVKQLKRPVSLPKPRNGQWVYYNYSNVIYMDKENNQEKRDVLKAVLQK
QEMPNRSVRFTVVSDPPEDEQDLECEDIGVARVDLADLFREGRDIIEQNIDVFDARADGE
SIGKLKVTVEALHALQSVYEQYREDLEV
Download sequence
Identical sequences G5BSE2
HGL_H00000369257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]