SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369317-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369317-4
Domain Number 1 Region: 276-353
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-22
Family Intermediate filament protein, coiled coil region 0.00036
Further Details:      
 
Domain Number 2 Region: 109-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000507
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  HGL_H00000369317-4
Domain Number - Region: 186-276
Classification Level Classification E-value
Superfamily Prefoldin 0.000392
Family Prefoldin 0.022
Further Details:      
 
Domain Number - Region: 119-178
Classification Level Classification E-value
Superfamily Tropomyosin 0.00817
Family Tropomyosin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369317-4
Sequence length 432
Comment KRT6A (Homo_sapiens) keratin 6A
Sequence
MVISGTGRWAVARHAIESRKSIGGGLRGGFGTRSLQGFGGSKRISINGGYHSSRRNFGGA
SCGLGIGGIGYRAGEAFGGYGFGGGMVPGAEGIHEVTVNQSLLTPLHLTLNNKFASFIDK
VCFLEQQNKVLETKYEEEINRHTAAENEFVVLKKDMDAGYMNKVELEAKVDALMDEINFL
RAFYKAELAQLQAQISKTSVVLSMDNNHRLDLDSVIAEVKAQYEEIANGSWAEAESWYQT
KYEELQWSAGQHGDDLRTTRMEISELMRAMQRLSSEIDNLKKQCTTLQATIADAEEHGEL
ALKDARNKLAGLEDALQKAKQDMARLLREYQELMNVKLALDIKIATYCKLLEGEEHRVKV
SGRGAVVSSSGGTGYSGGSGFCVGGGGYSGGLCYSATGDSSFSSTSGHSLSSTSSSMHII
SKTSSTKKSCRS
Download sequence
Identical sequences G5B3P6
HGL_H00000369317-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]