SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369320 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369320
Domain Number 1 Region: 54-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369320
Sequence length 216
Comment RS1 (Homo_sapiens) retinoschisin 1
Sequence
MPAFGSDFSDFCPSGCLQDEGEDPWYHKACKCDCQGGANALWSAGATSLDCIPECPYHKP
LGFESGEVTPEQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLK
EVKVISGILTQGRCDTDEWMTKYSVQYRTDEHLNWIYYKDQTGNNRVFYGNSDRSSTVQN
LLRPPIISRFIRLIPLGWHIRIAIRMELLECVSKCT
Download sequence
Identical sequences G5BDT5
HGL_H00000369320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]