SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369456 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369456
Domain Number 1 Region: 19-199
Classification Level Classification E-value
Superfamily ITPase-like 6.28e-50
Family ITPase (Ham1) 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369456
Sequence length 217
Comment ITPA (Homo_sapiens) inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
Sequence
MGFRSSEGYLLFAMAASFAGKKIVFVTGNAKKLEEISVSCGVGPSLGGLGVLGRVGAYFW
VQVSGMHVLVLQVQGPVLVEDTCLCFSALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKS
AYALCTFALSTGDPSEPVSLFRGRTSGQIVAPRGCRDFGWDPCFQPDGYEQTYAEMPKAE
KNAISHRFRALLELQQYFGSLTPGAGGGASGWGSGES
Download sequence
Identical sequences G5B4T5
HGL_H00000369456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]