SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369579 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369579
Domain Number 1 Region: 233-526
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.42e-70
Family Ankyrin repeat 0.000021
Further Details:      
 
Domain Number 2 Region: 110-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-27
Family Ankyrin repeat 0.00067
Further Details:      
 
Domain Number 3 Region: 552-646
Classification Level Classification E-value
Superfamily DEATH domain 3.7e-18
Family DEATH domain, DD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369579
Sequence length 660
Comment ANKDD1A (Homo_sapiens) ankyrin repeat and death domain containing 1A
Sequence
MSKADRGSAGEQELGPKRGAETKSEGHYDCACILLPYPRPAAATTQPEALERGHSGRIPI
GLLIRTHMEHCRELQTFDCILQLSSAQSDPVCASTSNSVGGRLLPLEIQLHEAARRNQVG
RMKELIARKVNVRVRNHVGRVALHWAAGAGHEQAVRLLLEHGASVDDADAFGMNAILLSA
WFGHLQVLQILVNSGAKIHCENKDGLALLHCAALRGHMPVLAFMMEDLEDVALDHRDKRG
RTAFHKAAEHGQLEALDFLVGSGCDHSVRDKEGNTALHLAAGQGHTAVLQRLVDIGLDLE
EQNAEGLTALHAAAEGTHPDCVQRLLGAGSHVNALTQKKMSCLHYAALSGSEAVCQALIR
AGGCTNVADYQGTSPLHLAVRHNFPALVELLIDAHSDLNAIDNKKMSCLHYAALSGSEAV
CQALIRAGGCTNVADYQGTSPLHLAVRHNFPALVELLIDAHSDLNAIDNRQQTPLHLAAE
HARQDVAEMLLIAGVDLNLRDKQGKTALAVAARSNHITLVDMIIKADRLYRREKGPQRPP
GKSLTFRQDHGQETQQLHSVLWRLASRHLRPHEWKKLAFSWEFTEAHVSAIEQQWTGTRS
YQEHGHRMLLIWLHGMTLAGKNPSKALFEGLVAIGRRDLAESIRKKVNAEPRAPRSCMAM
Download sequence
Identical sequences G5AN74
HGL_H00000369579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]