SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369677 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369677
Domain Number 1 Region: 870-1010
Classification Level Classification E-value
Superfamily TNF-like 1.57e-25
Family TNF-like 0.0027
Further Details:      
 
Weak hits

Sequence:  HGL_H00000369677
Domain Number - Region: 493-573
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369677
Sequence length 1017
Comment EMILIN1 (Homo_sapiens) elastin microfibril interfacer 1
Sequence
MAPSTFWSCYLCCLLTTAVGAASYPPRGYSLYTGGSQTLSPGGPQAQSAPRPASRHRNWC
AYVVTRTVSCVLGDGVETFVKPDYQPCSWGQPQCPRNIMYRSFLRPRYRVVYKTVTDMEW
RCCQGYGGDDCAEGPAPATGPALSTPHPRPRPARPNLSGSSAGSHLSGLGGEGPGESEKV
QQLEEQVQSLNKELQGLRGVLQGLSGRLAEDVQKAVETAFNGRQQLADAAARPGVHETLN
EIQHQLQLLDNRVSTHDQELGHLNNHHSGAGGGGSRDSAPVPAPPGSNEELLRQLERRLQ
ESCSVCLAGLDGFHQHQQEDRERLRVLEKLLASVEERQRQLMGPAMGRRPPQECCPPDLA
RRLADLERRLDVVAGSVTVLSGRRGTELGGASGQGGHPPGYTSLASRLSILEDRFNSTLG
PSEEQEEGWPERPGGLGHWLPVARGRLEKLEELLANVSGGLGGRLDLLEEQVSGAVQACG
QLCAGAPRDQDSQVGEILSALERRLLDSEGQLRLVGSGLHKLEAAGEAQQTMLEELQGVV
GQLQEHMDAQDETAAELMLRLNLTAAQLGQLEGLLQARGDEGCGACGGVQEELGRLRDGV
ERCSCPLLPPQGPGAGPGVGGPSRGPLDGFSVFGGSSGSALQALQGELSEVILTFSSLND
SLHELQTTVEGQGADLADLGATKDSIISEINRLQQEATEHVTESEERFRGLEAGQAQAGQ
CPSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAGLRETNSSSQAQAALLEKL
LGGQAGLGRRLGALNSSLLLLEDRLQQLSLRDLTGPPGEAGPPGPPGMQGPPGPAGPPGP
PGMDGQRGSTGPPGPQGEQGVEGAPAVSVPRVAFSAALSLPRSEPGTVPFDRVLLNDGGF
YDPESGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNLGVARIDSGGYEPEGLENKPVA
ESQPSPGALGVFSLILPLQAGDTVCIDLVMGQLAHSEEPLTIFSGALLYGDLELEQL
Download sequence
Identical sequences G5BYZ1
HGL_H00000369677 XP_004839220.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]