SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369853 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369853
Domain Number 1 Region: 224-353
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000889
Family PLC-like (P variant) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369853
Sequence length 650
Comment C2CD2 (Homo_sapiens) C2 calcium-dependent domain containing 2
Sequence
MSCWVMEKAGLSYRLPPTLLWGKSSRNAPDSRRKQLDMSLAVTKGPLRLSFQQDPRPQPL
QLAVSEVSSVAKSSQEKVVTCRAVGDALQFLVSVGPASSEDPGCQLCDVRLSPVHLQLEF
HMREKREDIQIQWSFIPMPETDVQVQPCTPAAAEPPRCLRLSRADLGPGHRCDELESPSP
PRTALGRCQVVKASNRDQVMRQEVPGARVTDCCPPKPPRAHELRLQVKNIRASLLLDPGA
SGGTSPVCMAQLDDPAQSFTSSRVRNTTDLAWEEEFTFELNAKSRELYLQILEEGRPSEG
PVAMVPLDLFRKQPSGPQSFTLTSGPGLGSTVLGSVTAEFSYTEPGEPKALHALAPMPTA
QVEKDRTVLPCGTVVTTVTALKTKPRFDSGRASDSPVRTPVKVKVIEKDISVQAISHHSA
PVSKTLSSSDTELLVLSGSDPVAEVAIRQLSESSKLKLKSPRKKSTLIISGVSKACLSQD
HDAALRMDHSASVHSAHQDDGPATASAPPAGPEPILVPAALEGPQPEPDPEPWDLEKEEV
AAWSQPCLLAPGGDRDGDGLSESSLSTSELGNARKRKGGILRKGAKLFFRRRHQQKDPGM
SQSHNDLLFLQQPEGPRRKGKTLTRILNKKLLPRQRGRDAVNGLPGEPCT
Download sequence
Identical sequences G5BK28
HGL_H00000369853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]