SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369855 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369855
Domain Number 1 Region: 5-207
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.82e-50
Family Ankyrin repeat 0.0000939
Further Details:      
 
Domain Number 2 Region: 220-261
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000811
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369855
Sequence length 263
Comment ASB9 (Homo_sapiens) ankyrin repeat and SOCS box-containing 9
Sequence
DIVSYWSPVHEAAIHGRLFYLRNLINQGWPVNINTADQVSPLHEACLGGHPSCANMLLRH
GAQVNAVTTDWHTPLFSACISGSVDCVNLLLQHGASPHSESDLASPIHEAAKRGHVECIE
SLVAHGANINHNISHLGTPLYVACEKQQLACAKKLLESGASVNQGRDLDSPLHAVARLSN
GELACLLMDFGANAQARNADGKRPVELVPPDSPLINFFLQREGPASLMELCRLRIRQCFG
IQQHHKISELILPETLKQFLLHV
Download sequence
Identical sequences G5C240
HGL_H00000369855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]