SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369887-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369887-2
Domain Number 1 Region: 319-408
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.52e-20
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 2 Region: 16-53
Classification Level Classification E-value
Superfamily SAP domain 0.0000000311
Family SAP domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369887-2
Sequence length 588
Comment SLTM (Homo_sapiens) SAFB-like, transcription modulator
Sequence
MAATASTVGSAEGKNIAGLRVIDLKSELKRRNLDINGVKTVLVSRLKHAIEEEGGDPDNI
ELTVSTDTPNKKPTKGKGKKQEADELSGDASVEDDAFVKDCELENQEAHEQDESGEIKDP
EEFGENEEENANSKELLSAEENKRAHELIEAEAKEDAEKEDIESQDIEAQEGEDDTFLTA
QDGEEEENEKDIAGSGDGTQEVSKSLPSEGNLAGADHTAHEEMEANVTVKEAEDDNISVT
VQAEDAITPDFDGDDLLETGKNVKITDSEASKPKDGQDVVAQRPEKETKDYEMNVNHKDD
SKTSSKDDKGSTSSTSGSSGSSTKTIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNAR
SPGAKCYGIVTMSSSTEVSRCIAHLHRSELHGQLISVKKVKGDPSKKEMKKENDEKSSSR
SSGDEKNMNDRSSKTQTSVKKEEKRLSIKSEKKESRDNKKMESKEEKNDNGASGQISESI
KKNEEKKRISSKSPGHTVILDQTKGDHCRPSRRGGYEKIHARSKEKERASLDKKRGKDYR
RKEILPYGKMKEQRLREHLVGFERLRTSNGTSKMKRDCRKRAWRARTN
Download sequence
Identical sequences G5BIQ0
HGL_H00000369887-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]