SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369887-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000369887-3
Domain Number 1 Region: 314-397
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000109
Family Canonical RBD 0.0042
Further Details:      
 
Weak hits

Sequence:  HGL_H00000369887-3
Domain Number - Region: 16-41
Classification Level Classification E-value
Superfamily SAP domain 0.0104
Family SAP domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369887-3
Sequence length 397
Comment SLTM (Homo_sapiens) SAFB-like, transcription modulator
Sequence
MATAAGAVGSVEGKKIADLQVIDLRSELKQWDLDINGVKMDCELENQEAHEQDESDEIKD
SEKFGENEEENAHSKELLSAEENKRAQELIEAEAIEDVEKEDIENQVFRKEDIENQDIEA
QEGEDDTFLTAQDGEEEENEKDTAGSGDGTQNVSKPLPSEGNLAEADHTAREEMETNATV
KEAEGDNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDRQDVIPQSLEKETK
DYEMNMNHKDGKKEDFVKGDPVQKEAKESSNKAESGDKEKDSLKKGPSSTGASGQAKSSS
KESKDSKTSSKDDKGSTSSTSGSTGSSTKNIWASGLSSNTKAADLKNLFGKYGKMLNPKV
VTNAQSPRAKYYGIVIMSSSTEVSRCIVHLHQTELHG
Download sequence
Identical sequences G5C0X4
HGL_H00000369887-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]