SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370055 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370055
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.48e-29
Family Ubiquitin-related 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370055
Sequence length 117
Comment UBL3 (Homo_sapiens) ubiquitin-like 3
Sequence
MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRL
IYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCIIL
Download sequence
Identical sequences G5ATT7
XP_004854846.1.39548 HGL_H00000370055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]