SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370158 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370158
Domain Number 1 Region: 319-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.74e-23
Family Intermediate filament protein, coiled coil region 0.0000878
Further Details:      
 
Domain Number 2 Region: 89-122
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000204
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000370158
Domain Number - Region: 91-236
Classification Level Classification E-value
Superfamily Tropomyosin 0.00333
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370158
Sequence length 539
Comment NEFL (Homo_sapiens) neurofilament, light polypeptide
Sequence
MSSFSYEPYYSTSYKRRYVEPPRVHVSSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRSLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQY
AQISVEMDVASKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVR
AAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELR
TTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSMGSITSGYSQSSQVF
GRSAYSGLQTSSYLMSARSFPSYYTSHVQEEQIEVEETIQAAKAEEAKDEPPSEGEAEEE
EKEKEEGEEEEGAEEEEAAKEESEEAKEEEEGGGEGEEAEEEEKKEEGAVEERAAKKKD
Download sequence
Identical sequences G5BYB0
HGL_H00000370158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]