SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370259-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370259-2
Domain Number 1 Region: 13-107
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.17e-25
Family Ankyrin repeat 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370259-2
Sequence length 344
Comment GABPB1 (Homo_sapiens) GA binding protein transcription factor, beta subunit 1
Sequence
MIGAAQSQREQGCQNQRGPDAVAHAASEGHASIVEVLLKHGADVNAKDVLKMTALHRASQ
HNDQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQININPESPDT
VTIRPVTPQFIIRPGGVAKLTGLVSSENLPKATDETGVSAVQFGNSSTSVSATLAALAET
SAPLSNSSETPGVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSILTSGI
GPPIIVTVPDEQQVLIVPATEVAEETVISEEPPAKRQCTEIIENQVESTEIEYPKREALQ
KQLDEANREAQKCRQQLLKKEQEAEAYRQKLEAMTHLQINKETA
Download sequence
Identical sequences G5C5K7
HGL_H00000370259-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]