SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370259-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370259-3
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.63e-49
Family Ankyrin repeat 0.0000000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370259-3
Sequence length 395
Comment GABPB1 (Homo_sapiens) GA binding protein transcription factor, beta subunit 1
Sequence
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTGLVSSENSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNS
SETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVT
MPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANRE
AQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV
Download sequence
Identical sequences A0A096NM26 A0A2J8VBK9 A0A2K5PNY4 A0A2K5YC64 A0A2K6BSS5 F2Z5T9 F7I4F7 G1R306 G3RTC1 G5CA49 G7MXA4 G7PBG1 H0WQC3 I3MQZ4 K7CNS9 L5K3V4 L8ISB0 L8Y8E9 M3X358 Q06547 W5QIK6
ENSOGAP00000004144 ENSPTRP00000012078 ENSOCUP00000014482 ENSP00000220429 ENSPANP00000014035 ENSCJAP00000002623 ENSFCAP00000021058 HGL_H00000370259-3 ENSP00000220429 gi|8051593|ref|NP_005245.2| ENSMMUP00000003849 ENSOARP00000022558 NP_001307839.1.87134 NP_001307839.1.92137 NP_005245.2.87134 NP_005245.2.92137 XP_001114320.1.72884 XP_001928253.3.46622 XP_002717849.1.1745 XP_002753521.1.60252 XP_003266959.1.23891 XP_003928910.1.74449 XP_003987195.1.62641 XP_004010669.1.66739 XP_004281330.1.21590 XP_004421624.1.5094 XP_004471606.1.11602 XP_004611834.1.94378 XP_005254331.1.92137 XP_005316614.1.77405 XP_005559588.1.63531 XP_005638458.1.84170 XP_005685845.1.57651 XP_005892227.1.15283 XP_005979924.1.78601 XP_006077852.1.26621 XP_006168825.2.99106 XP_006168826.2.99106 XP_006168827.2.99106 XP_006168828.2.99106 XP_006181365.1.101512 XP_006208413.1.17985 XP_006920432.1.64745 XP_006932591.1.62641 XP_007081900.1.5354 XP_007081901.1.5354 XP_007115976.1.24612 XP_007170474.1.59432 XP_007455590.1.90284 XP_008267243.1.1745 XP_009427379.1.37143 XP_009427380.1.37143 XP_010337792.1.74449 XP_010354911.1.97406 XP_010963601.1.22495 XP_010994122.1.51371 XP_011353396.1.92234 XP_011353397.1.92234 XP_011754493.1.29376 XP_011754502.1.29376 XP_011754508.1.29376 XP_011851150.1.47321 XP_011851152.1.47321 XP_011920705.1.92194 XP_011920706.1.92194 XP_011920707.1.92194 XP_011920709.1.92194 XP_011920710.1.92194 XP_011973994.1.54773 XP_011973995.1.54773 XP_012036965.1.66739 XP_012362788.1.23891 XP_012618952.1.48125 XP_012618953.1.48125 XP_012618954.1.48125 XP_012618955.1.48125 XP_012618956.1.48125 XP_012618957.1.48125 XP_012618958.1.48125 XP_013365747.1.28644 XP_013848462.1.46622 XP_014439744.1.99106 XP_014918948.1.86478 XP_014918949.1.86478 XP_014997687.1.72884 XP_014997688.1.72884 XP_014997689.1.72884 XP_015307923.1.63531 XP_015307924.1.63531 XP_015307925.1.63531 XP_015336161.1.40921 XP_015392915.1.5354 XP_015451494.1.64745 XP_015984102.1.101085 XP_015984103.1.101085 XP_015984104.1.101085 XP_015984105.1.101085 XP_015984106.1.101085 XP_017203514.1.1745 XP_017400393.1.71028 XP_017751673.1.44346 XP_017751674.1.44346 XP_017751676.1.44346 XP_017751677.1.44346 XP_017909674.1.57651 XP_018866513.1.27298 XP_019065310.1.5607 XP_019520261.1.44202 XP_019520277.1.44202 XP_019520286.1.44202 XP_019586220.1.88060 XP_019586221.1.88060 XP_019586222.1.88060 XP_019586223.1.88060 XP_019586224.1.88060 XP_019687999.1.62641 XP_019784886.1.83887 XP_019824409.1.53367 XP_019824410.1.53367 XP_020039230.1.5219 XP_020751507.1.74333 XP_020751509.1.74333 XP_020751511.1.74333 XP_020751512.1.74333 XP_020951360.1.46622 XP_510397.2.37143 XP_850867.1.84170 ENSNLEP00000007578 ENSNLEP00000023609 ENSPTRP00000012078 ENSNLEP00000007578 ENSP00000370259 ENSCJAP00000002648 9544.ENSMMUP00000003849 9598.ENSPTRP00000012078 9606.ENSP00000370259 9615.ENSCAFP00000022272 9823.ENSSSCP00000005005 9986.ENSOCUP00000014482 ENSMMUP00000003849 ENSOGAP00000004144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]