SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370373 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370373
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily FKBP-like 8.25e-35
Family FKBP immunophilin/proline isomerase 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370373
Sequence length 96
Comment FKBP1B (Homo_sapiens) FK506 binding protein 1B, 12.6 kDa
Sequence
GRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQVGLGQR
AKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Download sequence
Identical sequences G5C383
HGL_H00000370373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]