SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370718 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370718
Domain Number 1 Region: 12-75,108-230
Classification Level Classification E-value
Superfamily ITPase-like 4.9e-47
Family Maf-like 0.0000367
Further Details:      
 
Domain Number 2 Region: 363-552,591-613
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.19e-23
Family Plant O-methyltransferase, C-terminal domain 0.008
Further Details:      
 
Domain Number 3 Region: 279-356
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000404
Family Plant O-methyltransferase, N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370718
Sequence length 632
Comment ASMTL (Homo_sapiens) acetylserotonin O-methyltransferase-like
Sequence
MALSPVLGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSRFKETLSKSSFPSPYAYAME
TAKQKALEVATRLHQASTRPSLPAPTAHAMHTNLAHALAGGAQPQASERKDLQAPDLVIG
ADTIVAVEGLILEKPVDKQDAYRMLSRLSGKQHSVFTGVCVVLCDSRDGQLETEVSEFYE
ETRVKFSELSEEMLWEYIHSGEPMDKAGGYGIQALGGMLVEAVHGDFLNVDLGSQAKQDS
IHCVDSFEGLSDPEPKHGDGDVDLEPRSGPRDARPAFPASLLRLVHGFKAAQALFTACKL
KVFDLLQDGAARTASDVAGKVKASVCGTRRLLDVCVGLGLLQKTERGYRNTEVAGMYLGS
HGEYSLHSYILHTGGHAWDLFMHPASTAKEGRSHQHPAEGTKPGDPSQVQLERAQQHLLR
AAHGLAQLTAHEVATAMDLSSFSSACHLGGCTGALAHELAREYPRLKVTVFDLPHIIQQA
PLFRPHGPETAQVSFMPGDVLWDPFPEAELYILAPALPDWTGSAAQQLLRRVAAACRPGC
GLLVADAFPMGEEEEEEEEELDEAEEEAEAGSAPAGLVRVLDQLVWPKAGGCSVGACCRW
LEQLGFCDLQVAPSGDTQTATLTVLLGTRAGP
Download sequence
Identical sequences G5BQT1
HGL_H00000370718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]