SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000370723 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000370723
Domain Number 1 Region: 314-416
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.77e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 71-144
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 158-225
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000275
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000370723
Sequence length 907
Comment CLOCK (Homo_sapiens) clock homolog (mouse)
Sequence
MAREAGSWKQQAASSKQQAANSKQQTANSSSSRQDSLSLLSHSGYKPFGWYHPCPGDDSS
IFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDF
LRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTS
LLEHLPSDLVDQSIFNFIPEGEHSEFYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRG
TIDPKEPSTYEYVRFIGNFKSLNSVSTSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATP
QFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLEN
LAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAE
VRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKS
SHTAVSDPSSTPTKIPTDTSTPPRQHLPTHEKMAQRRSSFSSQSINSQSVGPSLTQPVMS
QAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHG
QGLQMFLQQSNPGLNFGSVQLSSGNTSAIQQLTSINMQSQVVPANQIQSGMSAGHMGTSQ
HLMQQQTLQSTSTQQSQQSVLSGHSQQTSLPSQTQSALTAPLYNTMVISQPAPGSMVQIP
SSMSQNSTQGGAVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYP
TFTTQQQQAQTLSVTQQQQQQQQQQQQQQQQQQQQQQQQQQSSQEQQLPSVQQPSQAQLT
HPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQPQQLGRHRTDSLTD
PSKVQPQ
Download sequence
Identical sequences HGL_H00000370723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]