SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371085 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371085
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-63
Family IMD domain 0.00004
Further Details:      
 
Domain Number 2 Region: 361-437
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000748
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371085
Sequence length 560
Comment BAIAP2L2 (Homo_sapiens) BAI1-associated protein 2-like 2
Sequence
MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGE
QALQSSTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHMEKNTKLDMQFIKDSRQ
HYEIEYRHRAANLEKCMSELWRMERKRDKNAREMKESVNRLHAQMQAFVSESQRAAELEE
KRRYRFLAEKHLLLSNTFLQFFGRCPVLGTRSLVLHCAWSFFMVAQSRSLDPWGPVNPRS
GHPQVGEASSLLLALGHFSVRSEDAPPPGLLSCEPPASGGRPAPPWAAVGRHGRGVALQE
ELQLEQSGPQARDRARSASQLEPERRSLPRTPSASSLYTGSAQRSRSNSFGERPGGGGGA
LRVRALVSHSEGANHTLLRFAAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKPLE
EVPVNPMTPLSPMTAMNPMSPMNELSSRSYPLRGSHSLDDLLDRSGHSTASPEYLDGQAR
SRNPSRVPSQVPSCNPSPTPTPLPGSRRSSMGSMGVASDVKKLMAWEQHPPELFPRGTNP
FATVKLRPTVTNDRSAPLIR
Download sequence
Identical sequences G5AYS5
HGL_H00000371085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]