SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371321 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371321
Domain Number 1 Region: 1152-1291
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.24e-48
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0000779
Further Details:      
 
Domain Number 2 Region: 887-1140
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-32
Family Extended AAA-ATPase domain 0.0000116
Further Details:      
 
Domain Number 3 Region: 702-779
Classification Level Classification E-value
Superfamily BRCT domain 3.78e-18
Family DNA ligase 0.001
Further Details:      
 
Domain Number 4 Region: 227-322
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000277
Family Canonical RBD 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371321
Sequence length 1454
Comment RFC1 (Homo_sapiens) replication factor C (activator 1) 1, 145kDa
Sequence
MVVLCVELGTKGEKQIAAEDAPNCGHYELEAPLGSWIELCLADLAVWLLSPEEVWHGDGG
FGRRLAFKRAQRLLTFWKLGVLGQEKDIRKFFGVVPSGKKLVGETVKKNEKTKAAEETLK
AKKGIKEIKVNSSYKEDASKQKQPNKKKRIIYDSDSESEETVQVKSAKKQSEKSPLSSKP
GKILRQDPVTYISETEQNKSKKKNKLAEDAEMKSLEEKIGYLLKFSGDLDDQTCREDLHV
LFSNHGEIKWIDFVRGAKEGVILFKEKVKEALDKARDVNNGSLQLRNKEVTWEVLEGEVE
KEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKATQPGSAKGKQCLNSFQWSENGFCYSF
KYCSRTTGFDSIKLLPKEDLLNWKCDCYIAESCTAAAQIMLHFTNTGNALAQRLVPAACR
IAYEDDDFMCKKTASKAKENGGSTNTYLGTSNMKKSEENTKNKNKPLSPIKLTPTSVLDY
FGTGSVQRSDKKMVASKRKETSQNTDDSRLNDEAIAKQLQLDEDAELERQLHEDEEFART
LAMLDEEPKTKKARKDTEEGETFSSVQANLSKAEKRKYLPKEKFSKEKKSYNPNKQTKCE
SSKESPQHSSSLKASSKLALLKTKEECSYKETEPVPSKRKENTVELKGEKKTPKKPKSSP
AKKESTSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLTFVITGVLESI
ERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRT
MPGKKSKYEIAVEAEMEKGKSKLERTPQKNNQGKRKISPNKKESESKKNKQTPKRDSSTK
TIKKETEVTNVFRRGLDFKEQVAEETNGDSRPRELADESSESKVDSLLWVDKYKPTSLKT
IIGQQGDQSCANKLLRWLRNWHKSSPDEKKHAAKFGKFAGKDDGSSFKAALLSGPPGVGK
TTTASLVCQELGYSYVELNASDTRSKNSLKAIVAESLNNTSIKGFYSSGAGGAEASVSAK
HALIMDEVDGMAGTEDRGGIQELIGLIKHTKIPIICMCNDRNHPRIRSLVHYCFDLRFPR
PRVEQIKGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSLWCARSKALTYDQAK
ADSHRAKKDIKLGPFDVARKVFAAGEETAHMSLMDKSDLFFHDYSIAPLFVQENYLHVKP
VAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPTQAIYASVLPGELMRGYMT
QFPTFPSWLGKHSSTGRHDRIVQDLALHMSLRTYSSKRTVNMDYLSHIRDALVQPLTSQG
VEGVQDVVALMNTYYLMKEDFENIMEISSWGGKPSPFSRLDPKVKAAFTRTYNKEAHLTP
YSLQVIKTPRSSTGPMLDSDYNEELHEDDSQSDEKDQDAIETDAMIKRKTKSSKPSKAEK
DKESKKGKGKSLKK
Download sequence
Identical sequences G5C3V0
HGL_H00000371321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]