SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371341 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371341
Domain Number 1 Region: 175-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-75
Family Protein kinases, catalytic subunit 0.000000000186
Further Details:      
 
Weak hits

Sequence:  HGL_H00000371341
Domain Number - Region: 448-474,561-602
Classification Level Classification E-value
Superfamily SH3-domain 0.000175
Family SH3-domain 0.0045
Further Details:      
 
Domain Number - Region: 2194-2236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0207
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1140-1172
Classification Level Classification E-value
Superfamily UBA-like 0.0279
Family UBA domain 0.039
Further Details:      
 
Domain Number - Region: 36-97
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0977
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371341
Sequence length 2280
Comment TNK2 (Homo_sapiens) tyrosine kinase, non-receptor, 2
Sequence
MPAARRFPGLELSFPLLARLRRRLYTRLGSSSMQPEEGTAWLLELLSEVQLQQYFLRLRD
DLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKLGGAVGSTGP
VPWKEQDLGSRPKVFSGKRLEAEFPPHHSQSTFRKPSPTPGAPAGEGPLQSLTCLIGEKD
LRLLEKLGDGSFGVVRRGEWDSPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLD
HRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLES
KRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTR
TFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMV
QCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGSSSGGGG
TLSLSVGQSTWWGDPVLPAQPTSGCIDRAWSVSATLGVRITSGPYKTPERVLRRVESREE
EGVVAHPEADCNWGLPWDLPSPETPGVGWREDVRAENYWWRGQNTRTLCVGPFPRNVVTS
VAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNPMDPPDLLSVELSTSR
PSQHLGRLKKPTYDPVSEDPDALASDFKRLGLRKPGLPWGLWLSKPSARVPGTKAGRGVS
GGASEVTLIDFGEDPVVPAPRPCAPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVV
DWDARPLPPPPAYDDVAQDEDDFEVCSINSTLVGTGLATGPCQGETNYAFMPEPERCPLA
LEDNLFLPSQGGAPPPSSAQTAQIFQALQQECMRQLQVPTGSLAPSPGPASDDKPQVPPR
VPIPPRPTRPRVELSPAPSGEEELGRWPGPVSPPRVPPREPLSPQSSRTPSPLVPPGSSP
LPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGRKVSSTHYYLL
PERPPYLERYQRFLREASSPEEPALQPVPLLPPPPSTPAPAAPTATVRPMPQAAPDPKAN
FSTNNSNPAVRPPTSQRGCPGDGLETARQADEVQMVRGWAVGGQSQGTQQAGHGADGHCA
QLQAMVHGVTTEECQAALQCHGWSMQRAAQYLKVEQLFGLGLRPRLECHKVLEMFDWNLE
QAGCHLLGSFGPAHHKKLTCERGGSGRDRRPLCSSRCHFCATQLQPRTVWSYEREALDQG
PLGAPELPVLLPPGLHTLLLPGPGVPLFPYGVSHGDRHFVRIAVDFTSQLFRIKIGFPLG
SSLWDSFYVNNGQIFFPESDYQIFPYPNPPPGGFTGRDPVATVAPFWDDADFSSQKGEIF
YQEYETLYNEPNCPQTNTYQAILSTDGSRSYALFLYQSGGMQWDVTQHQGNPVLMGFSSG
DGYFENSPLMSRPLWEKYRPDQFLDPKLGVRRLQIYRLHREERPNFRLRCLQRLSSQQLS
SQAPSWARRPIFCPCSWQQGRWDLRFQPLRIGRELETQNWCCRWNDHPRFCALYHEQWPQ
VGCAAYRPPRPAWMFGDPHITTLDDTSFTFNGLGDFLLVRAWGSNSSFLLEGRTAQTGSA
SATNFIAFATQYEAGRLNPITVQFLLGPNDTVHVLHNNGSVTFETSQEDAEGTEMFNATG
VLLMRNGSLVSASFDGTVTISVTALSNILHAVSSLPEEYWDHTKGLLGVWNNNPEDGFRM
PNGSCVPHNSSEEMLFHYGMTWALNGTGLLGMRHDPLPSNFTPIFLSQLSKNSPLASGCD
GDKQCIYDTLATGDTQASLHTRELFRMNQLMNATLNQFPPSISDCHVMEAYKDKTSQFQC
TSNSENVTFELQGNHTSFQILKNGTLLWAPNSPEPVTLEILVQDPKTGLSSVLQPKTVAR
FCSSRSQCLYNQTRRVGNSSLEEASCQCGKDTFGRHCERSKDPCDERCFPNVQCIPGRGC
GACPRFMTGDGRHCTALVDPLLCQNKSCPVNYCYNHGHCFVSQTQGCQLACTCPPAFTDA
RCFLAGNTFVPSVLGELPVRPIQLSLREEENATKEDVNASVAYRLEHLDVRAFLRNSHVE
HSHSIALPSGLSIQHWKVVSEFGYRPRGPVIHFLNQQLLDAVVRAFLTQEWGARQKSSPE
ARKLNTSNLGLYFKCYGYEGYHLVYRPQNGLTCVSPCSEDHCQHGGQCQHLPDGLHCSCV
SFSIYTSWGERCEHLSMKLGAFFGILFGSLGALVLLGVVVWVALRLRGLSKAEYPLPLEN
Download sequence
Identical sequences G5ALB1
HGL_H00000371341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]