SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371394 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371394
Domain Number 1 Region: 111-237
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.95e-31
Family Synaptotagmin-like (S variant) 0.0004
Further Details:      
 
Domain Number 2 Region: 238-358
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.44e-27
Family Synaptotagmin-like (S variant) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371394
Sequence length 390
Comment SYT8 (Homo_sapiens) synaptotagmin VIII
Sequence
LHDLLLQATRKMGRLPDPQSTPTPIGTTAMPGLIPDLVSGIIWPHWALIVAALAAGILAV
SCLLCAICCCCQRRHHRKKPQDKEVMSLGSACSSTTTHLVQPDVENLESSLGDPRRWGRM
QLSLAYDFGSQEIKVGLKQAADLRAEGMADPYARVSVSTQAGRRHETKVHHGTLCPIFEE
TCSFHVPPAELPSATLQVQVLDFKRFSEHEPLGDLCLPLGTLDPQHVMECWYQLGPPGTN
EAEQMGELCLSLRYVPSSGRLTVVVLEARGLSPELAEPYVKVQLMXKWKKKKTSTKKGTT
APYFNEAFTFLVPFSQVQNVDLVLAVWLRAEPVGKVLLGPRASGQPLQHWADMLAHARRP
ITQWHRLQPAKEVDRILALQPRLHLPVPHP
Download sequence
Identical sequences HGL_H00000371394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]