SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371627 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371627
Domain Number 1 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 318-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.89e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 279-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-19
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 88-128
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000196
Family KRAB domain (Kruppel-associated box) 0.0039
Further Details:      
 
Domain Number 6 Region: 364-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000039
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371627
Sequence length 527
Comment ZNF205 (Homo_sapiens) zinc finger protein 205
Sequence
MLSGLEKIVPLGAAHASQHIKMEPEEPEPEGASQEDRAPGGCGRLSIRPGSKEKALLPGG
VLSSPRIPVLSLEGRTRDQQMAAALLTAWSQMPVTFEDVALYLSREEWGRLDHTQQNFYR
DVLQKKNGLALGFPFSRPFWAPQVPGKVETSSSSRQTGAEEESDAGSGAVEVGKEALAKS
VAALGHVKPFFSRAGWVSGQGPQWRQQVTSDQNAGSARDTGQPAPGEARWPALTLPNTHP
TKTLEGCIPENPKNPSEEGKGAPESGEEGLAPDGEVGKKSYKCEQCGKGFSWQSHLVTHR
RTHTGEKPYACTDCGKRFSRSSHLIQHQIIHTGEKPYTCPSCWKSFSHHSTLIQHQRIHT
GEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICGKCFSQSSALVTHQRTHTGLKP
YPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFGHSSHLTAHQRTHRGVRPYACP
LCGKSFSRRSNLHRHEKIHSSGPKALAVLMLGAAAAGTLAAPPPAPT
Download sequence
Identical sequences G5B1I6
HGL_H00000371627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]