SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371634 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371634
Domain Number 1 Region: 310-395
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.32e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 127-205
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 3 Region: 405-484
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 16-116
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000137
Family Canonical RBD 0.018
Further Details:      
 
Weak hits

Sequence:  HGL_H00000371634
Domain Number - Region: 214-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371634
Sequence length 493
Comment IGF2BP2 (Homo_sapiens) insulin-like growth factor 2 mRNA binding protein 2
Sequence
MFRRKCYRVWFYLYRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNV
TYATREEAKIATEKLSGHQFENHSFKISYIPDEEVSSPSPPQGAQRGDHSSREQGHAPGG
SSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKKTQSRVDIHRKENSGAAEKPVTIH
ATPEGTSEACRMILEIMQKEADETKLLQDLSIYNPERTITVKGPVEACASAEVEIMKKLR
EAFENDMLAVNQQASLIPGLNLSALGIFSTGLSMLPPPAGPRGAPPAAPYHPFATHSGYF
SSLYPHHQFSPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPA
EGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIG
KGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQE
QKYPQGVASQRSK
Download sequence
Identical sequences G5BT98
HGL_H00000371634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]