SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371897 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371897
Domain Number 1 Region: 1273-1452
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000377
Further Details:      
 
Domain Number 2 Region: 28-64,128-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.59e-19
Family G proteins 0.0098
Further Details:      
 
Domain Number 3 Region: 427-488
Classification Level Classification E-value
Superfamily FF domain 0.000000903
Family FF domain 0.0053
Further Details:      
 
Weak hits

Sequence:  HGL_H00000371897
Domain Number - Region: 279-329
Classification Level Classification E-value
Superfamily FF domain 0.0279
Family FF domain 0.0068
Further Details:      
 
Domain Number - Region: 483-548
Classification Level Classification E-value
Superfamily FF domain 0.0458
Family FF domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371897
Sequence length 1503
Comment ARHGAP5 (Homo_sapiens) Rho GTPase activating protein 5
Sequence
MMAKNKEPRPPSYTISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFI
ALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYISTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRTDFQLCFVVLEKTPWDETDHIDKVNDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDESFKYITEADSKEVYSRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYILSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPVPTNKDVSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDSTRESTHQ
SEDVFLPSPRDCFPYNSYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
VHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDVDSSDNYAEPIDTIFKQKGYSDEIYVVPDDSQTRVIKIRNSFVNNTQGDEENGFSD
RPSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDP
LLSPVETWKGGIDNPAITSDQEVDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNY
FGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNIN
LVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIMDKTERLHALKEIVKKFHP
VNYDVFRYVITHLSRVSQQNKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVE
TFIQQCQFFFYNGEIVETANTVAPPPPSNPGQLVESMVPLQLPPPLQPQLIQPQLQTDPL
GII
Download sequence
Identical sequences G5AZT5
HGL_H00000371897 XP_004864080.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]