SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000372310-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000372310-1
Domain Number 1 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 311-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 143-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000133
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 2-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000209
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 6 Region: 107-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000152
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000372310-1
Sequence length 498
Comment ZNF596 (Homo_sapiens) zinc finger protein 596
Sequence
LLTIEDVTIKFTPEEWALLGTPQRKLYRNVMAENINHLLSLGGRRWGSKEKKRKDYISPH
FVKIHYLGQEWKNIQKNTCENHLCCKTYNHESLHRRNKVTESGIHSNKCHQGGKSFTCYA
ELRGHTKTNIVEKPYEGYMCRKSFSPTSNFNQHEGTQTHENQCDCQQCGKIFNYLSKFRR
HIRTHTGEKPFECHLCGKVFTQSSTLKQHKRIHTGEKPFECHLCGKAFTQSSNLKRHKRT
HTGEKPFECHLCGKAFTKSSHLSEHERTHTGEKPYECHLCGKAFTKSSHLSEHERTHTGE
KPYECHLCGKAFTKSSHLSEHERTHTGEKPYKCQLCEKAFKKSSSFRRHEKTHSREEKPY
ECHVCGKVFNQSCSLKNLEEYTQERNYMNVICVGKPSFNHVPLENIKEYTQERNYMNVIC
VGKPSLIHLTLHSIKEHTQERNHMHVFCVEKLSLNPVTLVNMREHTLERNHININCVRKP
SLNYLALGYMRKHTLERN
Download sequence
Identical sequences G5AW21
HGL_H00000372310-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]