SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000372310-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000372310-2
Domain Number 1 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-21
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 2 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-16
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-16
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000372310-2
Sequence length 298
Comment ZNF596 (Homo_sapiens) zinc finger protein 596
Sequence
LTMEDVTIKFTPEEWALLDTPQRKLYRNVMVENINHLLSLEYQLCESDLNFLSVDKEMLW
TVEGRVIPQLQHPERKIAPNIQERIRTQPIGKSDTPTIKVMLRGHTQSNITEKPYEGCMC
RKTFSPFLKHQHERTQTHEKQYEYQQCGNTFTHFSNFRRHNCTHTGEKPYACHLCGKAFT
DSSNLKNHKRTHTGGKPYRCDLYRKAFTQSNHLSGHKRTHTGEKPYECHLCGKAFTHLSK
LKNYKRTHTGEQSYECHLFGKAFSDSSNLKQHKRMHTGEKPYECHLCGKAFTFSCNLK
Download sequence
Identical sequences G5AXY2
HGL_H00000372310-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]