SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000372924 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000372924
Domain Number 1 Region: 187-368
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000372924
Sequence length 639
Comment RALBP1 (Homo_sapiens) ralA binding protein 1
Sequence
MTECFLPPPSSPGEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDVLHEPPDT
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KDKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEGPP
LDAPSLRPIFGIPLADAVERTMMHDGVRLPAVFRECVDYVEKHGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEDYEPNTVASLLKQYLRELPENLLTKELLPRFEEACGRAAESEKV
QEFQRLLRELPECNCLLVSWLVVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVL
FTHVQELFGNVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEETNENEEVIN
ILLTQENEILTEQEELLAMEQFLRRQIAAEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
ESESESEDEEELQLILEDLQRQNEELEIKNNHLNQAVHEEREAIIELRVQLRLLQLQRAQ
AEEEEEEEEEPEEPEEPVRPAGVPEAKPSPSRERKETPI
Download sequence
Identical sequences G5C062
HGL_H00000372924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]