SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373073 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000373073
Domain Number 1 Region: 85-651
Classification Level Classification E-value
Superfamily Urocanase 1.07e-220
Family Urocanase 0.0000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373073
Sequence length 676
Comment UROC1 (Homo_sapiens) urocanase domain containing 1
Sequence
MSSLQVLCSGLPLRPLPQNQGRWAGVPHAPVRTPGLSPMEEQLALRNALRYFPPDVQELL
APEFAQELRLYGHIYMYRFCPNIEMRAYPIEQYPCQTKAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFWLTMYYLSKMTEEQTLVMYSGHPLGLFPSTPGVPRLVITNGM
VIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEELA
GKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALVKRHQQGWLMEVTDSLDHCIERL
REARKKKEVLSLGYHGNVVDLWEHLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLS
FIEAQHLMASNPPAFKDLVQESLRRHISAINRLAKENFFFWDYGNAFLLEAHRAGADVAK
KGANKTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSRDPQDLAVTDQLATSVLEKAIADGV
KPSVKLQYMDNIRWIREAAKHQLVVGSQARILYSDQKGRVAIAVAINQAIARGNIKAPVV
LSRDHHDVSGTDSPFRETSNVYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGEV
INGGFGLMLDGSPEVEHKARMMLSWDVSNGVARRCWSGNPKAYEIICQTMQENSGLVVTL
PHDVTDECMLQQALQP
Download sequence
Identical sequences G5B0V5
XP_004854209.1.39548 HGL_H00000373073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]