SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373277 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000373277
Domain Number 1 Region: 37-182
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.55e-36
Family Canonical RBD 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373277
Sequence length 412
Comment RBMS3 (Homo_sapiens) RNA binding motif, single stranded interacting protein 3
Sequence
QQSYAPAPHPMAPPSPSTNSSSNNSSSNSSGEQLSKTNLYIRGLPPGTTDQDLIKLCQPY
GKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYI
SNLPISMDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKY
LKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNGRPWPREGEAGMALTYDPTAAIQNG
FYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHP
MSMQPTNMMGPLTQQMNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTP
VPPTAVSIEGVVADTSPQAVAPSSQDTSGQQQQIAVDTSSEHAPAYSYQQSK
Download sequence
Identical sequences G5B987
HGL_H00000373277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]