SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373301 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000373301
Domain Number - Region: 82-290
Classification Level Classification E-value
Superfamily Tropomyosin 0.00255
Family Tropomyosin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373301
Sequence length 485
Comment SH3BP5 (Homo_sapiens) SH3-domain binding protein 5 (BTK-associated)
Sequence
MEEEEEEEEEVEEVEEEGMEQGLEEEEEVDPRIQGELEKLNQSTDDINRRETELEDARQK
FRSVLVEATVKLDELAKKIGKAVEDSKPYWEARRMARQDARQKFRSVLVEATVKLDELAK
KIGKAVEDSKPYWEARRMARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKR
QFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSK
PYFELKGKYYVQLEQLKKTVDDLQAKLTLAKGEYKTALKNLERISDEIHERRRSSAMGPR
GCGVGAEGSGTSVEDLPGGKPEPDAVSVASEAFEDDNCSNFVSEDDSETQSVSSFSSGPT
SPLETPDQFPAVSRPGSLDLPSPVSLSEFGLLFPVLGPRSECSGASSPECEGERGDRAEG
AENKTSDKANNNPGLSNSSGGGRGRSQSSTSPEGQAVETRMKQLSLQCSKGRDGIIADIK
MVQTG
Download sequence
Identical sequences G5BUL6
HGL_H00000373301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]