SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373343 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000373343
Domain Number 1 Region: 133-263
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.8e-24
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 
Domain Number 2 Region: 12-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.51e-21
Family Synaptotagmin-like (S variant) 0.036
Further Details:      
 
Domain Number 3 Region: 296-478
Classification Level Classification E-value
Superfamily vWA-like 2.97e-17
Family Integrin A (or I) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373343
Sequence length 550
Comment CPNE9 (Homo_sapiens) copine family member IX
Sequence
MSFGGASERSVPATKIEITVSCRNLLDLDTFSKSDPMVVLYTQSRASQEWREFGRTEVID
NTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSRTNISKPDFLGQAFLALGEVIGGQGSRV
ERPLKGVPGKKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDG
TFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWDRDGSHDFIGEFTTS
YRELSKAQNQFTVYEVLNPRKKCKKKKYLNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFT
VAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPP
EGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARTAAKISD
GSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSS
RGRFAERDIVQFVPFRDYVDRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQPRPSPT
ANSSPTPAPQ
Download sequence
Identical sequences G5BX90
HGL_H00000373343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]