SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373594 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000373594
Domain Number 1 Region: 101-216
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000165
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373594
Sequence length 627
Comment C15orf27 (Homo_sapiens) Transmembrane protein C15orf27
Sequence
MALVAPFNMTDPQPAIEGGISEVEVISQQVEEETKSLAPVQLVNFAYRDLPLAAVDLSTA
GSQLLSNLDEEYQREGSNWLKPCCGKRAAMWQVFLLSASLNSFLVACVILVVILLTLELL
IDIKLLQFSSALQFASIIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIIL
SLAPMVASTVANGPRSPWDAISLIIMLRIWRVKRVIDAYVLPVKVEMEMVIQQYEKAKVM
QDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSHPRSRFKVLPLQ
QLPVIRVPSWEEKSVGVVFSQWPIDAGHQVPHWALQEHKAKPFVQSHTYGAARHYWSLSS
SASSQGPTGQLREGGERKQGKQDSRKGPARVRLSGSRAIRIWVPGRNFCETDAAMNDDMN
SYISQYYNGPSSDAAMNDDMNSYISQYYNGPSSDAAMNDDMNSYISQYYNGPSSDSGVPE
PAVCLVTTAAIDIHQTNISSDLFSVDTPLKLGDNSTCASATSEGASRSAQSSQLTAQDLL
SSLSENPYAPRRALDPATLTQPTREGSAHTSPELERRVCLFNRKNREGFAVVQIQPVLHF
PPTTPVLEEKLRSLESKEQPLHRVPEA
Download sequence
Identical sequences G5AUJ6
HGL_H00000373594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]