SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373600 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000373600
Domain Number 1 Region: 1244-1523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.83e-56
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 270-513,542-616
Classification Level Classification E-value
Superfamily L domain-like 9.35e-42
Family Leucine rich effector protein YopM 0.037
Further Details:      
 
Domain Number 3 Region: 640-828
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000141
Family G proteins 0.011
Further Details:      
 
Domain Number 4 Region: 59-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000363
Family Ankyrin repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 1384-1412,1528-1784
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000073
Family Quinohemoprotein amine dehydrogenase B chain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373600
Sequence length 2012
Comment LRRK1 (Homo_sapiens) leucine-rich repeat kinase 1
Sequence
MAGMSQSPPSMYWCVGPEGSTLSPERTMETQSGARDMGSKLSTPGGDSTAPRSPRMEGIY
TAYKQGDLSRARDLLRQACEDSTSQLEKGQLLSISAAHGDLETVRYLLTEKRVELSTEPT
DDNAAVVAAHFGHTEVVQELLESLSGKSQCTRSLPPPWALFLGYNQNSWHLGVVKLLVLT
HGADPQSYAVRRNEFPVIVRLPLYAAIKAGNEDIAIFLLRHGAFFCSYILLDSPDPSRHL
LRKYFIEASVLPGSRAGKTPLRVKWSHLRLPWVNLDWLIDISCQITELDLSANCLASLPS
VIPWGLINLQKLNLSDNQLGELPSVQSSDEIICSRLLDIDISSNKLSHLPPGFLHLSKLQ
KLTASKNYLEKLFEEESATNWIGLRKLQELDISDNKLTELPAVFLHSFKSLSCLNVSRNS
LKVFPDPWACPLKCCKASKNALESLPDKMCIFWKSHLKDVDFSENALKEVPIGLFQLDAL
MFLRIQGNQLVALPPPEKWTCRQLKTLDLSRNQFGKSEDGLKTKRISFFTTRGRQRSGSE
PGCVLEFPTFLSESLEVLCLNDNHLDAVPPSVCLLKSLSELYLGNNPGLRELPSELGQLS
NLWQLDVEDLSISNVPAEIRKEGPKAMLSFLRAQLRRAEKCKVMKMIVVGPPRQGKSTLL
EILQSGRASQVAHSEATIRTTKWELQRPAGSKAKVESVEFNVWDIGGPASMATVNQCFFT
DKALYVVVWNLALGEEALASLQFWLLSIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLR
AYVLALCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCNMKDVGSTIGC
QRLAGRLIPRSYLSLQEAVLAEQHRRSQGDDVQYLTDRQLEQLVGQTPGNDIKDYEDLQS
AINFLIETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLR
MLLVGTGFTKQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDMHGTRHPAANTIQ
RVFKMSFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVTIYSFTGNQRNRCST
FRVKRNQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGIKIICQSEMRDFSAMAFITD
HVNSLIDQWFPALTATESDGTPLMEQYVPCPVCETSWVQHADPSEKSEGVQYFDMEDCVL
TAIERDFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDESSILGQGGSGT
VIYRARYQGQPVAVKRFHIKKFKNFANAPADTMLRHLRATDAMKNFSEFRQEASMLHALH
HPCIVALVGISIHPLCFALELAPLSSLNTVLSENARDSSFMPLGHMLTQKIAYQIASGLA
YLHKKNIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEI
RPRIVYDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPLLGQPEEVQFHRL
QVLMTECWDTKPEKRPLALSVVSQMKDPTFATFMYLLPCGRQTAFFSSQGQAYTVVFWDG
KEESRNYTVVNTEKGLLEVQRMACAGMKLSCQIKVQSSLWTATEDQKIYIYSLKGMCPLN
APQQALDTPAVVTCFLAVPVIKKNSFLVLAGLADGLVAVFPVVRGVPRESCSYLCSHTAN
RSKFGIPDDDARQNPYAVKAMEVVNSGSEVWYSNGPGLLVIDCAALDISRRLEPYTTPSA
ITSVVCSSDCRGEEVVWCLDDKTNSLVMYHSATYQLCARYSCGDPSPLRDMFPVRPSGPE
ALHSHTASPQEPEGDCIADVSIMYSEELGTQILTHQDSLTDYCSMSSYSSSPPSSLLSPP
ASSPSMPFSTDCEDPERLQEPSATSGRSEHDLTPMDGEPLSQHLQAVKVLAVRDLIWVPR
HGGDIIVIGLEKDSGAQRGRVIAVLKARELTPHGLLVDAAVVAKDTVVCGFENENTEWCL
AVWRGWGARDFDIFYHSCEELGRLEACARKRR
Download sequence
Identical sequences G5ARZ1
HGL_H00000373600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]