SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000373930 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000373930
Domain Number 1 Region: 695-758
Classification Level Classification E-value
Superfamily EF-hand 0.0000493
Family Calmodulin-like 0.051
Further Details:      
 
Weak hits

Sequence:  HGL_H00000373930
Domain Number - Region: 837-913
Classification Level Classification E-value
Superfamily Tropomyosin 0.00216
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000373930
Sequence length 933
Comment KIAA1967 (Homo_sapiens) KIAA1967
Sequence
MSQFKRQRINPLPGGRNFSGAASTSLLGPPPGLLTPPVATDLSQNARHLQGGEKQRVFTG
IVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQP
LLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNR
FPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYTVDSPTCDF
LELQRRYRSLLVPADFLSVHLSWLSAFPLSQPFSLHHPSRIQVSSEKEVAPDTGAEPSPA
DSDPTYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQLKFLLGRKEDEAVLV
GGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSTCTKWWRFAEFQYLQPGPPRRLH
TVVVYLPDIWTIMPTLEEWDALCQQKAAEAAPPPQEAPGEAEPTEQAPDALSEQAADTSK
QNAETPEAATQQETDTDLPEAPPPPLEPAVMARPGCVNLSLHAIVEDRRPKERVSFEAGS
CCLFQQVMVLAELFLEMLQRDFGYRIYKMLLSLPEKVLSPPEPEKEEAAKEEAAKEEEAI
KEEVAKESKDEVQNEGTAAESDAALKEDGLLPKPPSSGGEEEEKPRAEVSEELCEMALDP
ELLLLRDDGEEEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFV
FFDANWCGYLHRRDLERVLLTLGIRLSAEQAKQLVSRVVTQNICQYRSLQYSRPETVDCS
LPEEVLFGNLDLLPPSGKSAKPGAAPTEHKGLVPHNGSLINVGSLLQRAEQQDSGRLYLE
NKIHTLELKLEESHNRFSATEVTNKTLASEMQELRARLTEAEDAARVAERQKGQLHRLLQ
EFRRRLGPLQLEVQRMVEKADSWVDKEEPAPSN
Download sequence
Identical sequences G5B9R0
HGL_H00000373930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]