SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000374218 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000374218
Domain Number 1 Region: 309-429
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.67e-30
Family PLC-like (P variant) 0.011
Further Details:      
 
Domain Number 2 Region: 754-882
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-29
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 
Domain Number 3 Region: 481-598
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.5e-16
Family Synaptotagmin-like (S variant) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000374218
Sequence length 886
Comment ESYT3 (Homo_sapiens) extended synaptotagmin-like protein 3
Sequence
MSVEEPCLPSAPRTPVARGAQRSPGPELRLTSQLLPELYTFVVRVLFYLAPVYLAGYLGF
SILWVLLGVLLWMWWRRNRRGKLGRLEAAFEFLNNERQFISRELRGQHLPAWIHFPDVER
VEWANKIIAQIWPYLTMIMENKVREKLEPKIREKSTYLRTFTFTKLYFGQKCPRVTGVKA
HTNKSNPRQVTLDLQICYIGDCEISVELQKIHAGVKGIQLQGTLRIILEPLLVDKPFVGA
VTVFFLQKPHLQINWTGLTNLLDAPGINEVSDSLLEDLIAAHLVLPNRVTVPVKKGLDVT
NLRFPLPCGVIRIHLLEAEKLAQKDNFLGLGCKSDPYAKVSIGLQHFRSRTIYKNLNPTW
NEVFEFMVYEVPGQDLEVDLYDEDTDKDDFLGSLQICLGDVMTNRVVDEWFVLNDTTSGR
LHLRLEWLSLITDQEALTEDHGNLSTAILVVFLENACNLPRNPFDYLNGEYRAKKFSRFA
KNKVSRDPSSYVKLSVGRKTYTSKTCPHSKDPVWSQVFSFFVHNVAAEQLCLKVLDDDQE
CALGVLEFPLCQILPYADLTLEQRFQLDHSGLDSLISMRLVLRFLRVEERELGSPYTGPE
ALKKGPLFVKKVVTNHGPKAPLQGEGPADLLCPPDPASYTMDASKSTLTTSSASTNPVPQ
ETILEPKGKDSANGFSEPMGKKKSSTTIFLTVPGPHSPGPIKSPRPMKRLASPFVWPPKG
LGPSISSLNSLASSCFDLTDTTFNTEVGNCRQQGLGEIQLTVRYVCLWRCLRVLVNGCRN
LTPCTSSGADPYVRVYLLPERRWAGRKKTSVKHKTLEPLFDETFEFFVPMEEVKKRSLDV
AVKNSRPLGSHRRKELGKVLIDLSKEDLIKGFSQWYELTPDGQQRS
Download sequence
Identical sequences G5BPL0
HGL_H00000374218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]