SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000375586-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000375586-2
Domain Number 1 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 25-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 5 Region: 275-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-18
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 493-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000097
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  HGL_H00000375586-2
Domain Number - Region: 217-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000733
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000375586-2
Sequence length 540
Comment ZNF304 (Homo_sapiens) zinc finger protein 304
Sequence
MVREVQETSEAGHLNGALMEGGWLRWQDSVTFGDVAVDFSWEEWKLLNEMQRLLYRDVML
ENFGLVASLGLVSSQIHVLVQLELEEDWVADRADLTVAAREPWRRTVSCSWFRVEDEEPP
SPGASWVRVPKVDLATLKAYPCGMCGPVMKDILLLAEQQGLHPRHKLHTCGSCGRQFWFR
ISIPQDQKQHSGRNHIRGHEDRDLHVNNCQLHVLGNPFTCEDGGKDILSSSCLLQHQTLH
TEGNFPIRTESNEAFHVREYHYECSEFEKSFSHIHGLQHQKIHTGDRSYSCSECGKSFRQ
KGRLVQHQKIHSREKAYQCSECGKSFRQSYGLIQHQRVHTGAKPYKCSECGSFFSYKTTV
IRHQRIHTGEKPYECSECGKFFRQRSGLIGHQTVHSGIKPFECSECGRFFSRKVTLIRHQ
RIHTGERPYKCTECGKFFSQTSGLISHQRVHTGEKPYECTECGKCFSHRSSLNLHQRVHT
GERPYECSECGKAFSLKSALVRHQRIHNEERTYKCSECKKSFTDKSSLVKHQRNHTEEKP
Download sequence
Identical sequences G5BXL1
HGL_H00000375586-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]