SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000375586-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000375586-3
Domain Number 1 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 494-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.05e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 439-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 1-41
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 6 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000507
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 401-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000104
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 8 Region: 541-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000013
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 625-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000951
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 10 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000122
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  HGL_H00000375586-3
Domain Number - Region: 154-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00014
Family Classic zinc finger, C2H2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000375586-3
Sequence length 661
Comment ZNF304 (Homo_sapiens) zinc finger protein 304
Sequence
VTFEDVFVYFSQEEWELLEEAQRFLYHDVMLENFALVATLAAALCQIPCNCPVGEGQKAQ
VSGREDTTLVTVEKGFCFPANQHAPHRISLLSGCWCEAGNEEACSEQSISVQKMSQIRTE
SGLFFQKAHPCVMHDTLLKAILHLDEYQGSYAMQKLHTCERCERGFSFIAKFYHHQRWHC
GDIPSWGNDGLASSVKSCTARVLGIPVVSREAGIDLLNSTGLFQPWTPHSEVIAWRRNEW
MESVPASSSVGQPQEDHHGQMIFSCRNDGKVFLNTVPLHDSQTTQTESSPFRCLPCGNVF
EQKLSLFNHREIHSGKRAHVCKCGKTFIHPSHLKMHQDCHTGKRHHMCSECGKTFSRKDT
LVQHQRVHTGERPFKCSECGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQSSHLIEH
WRIHTGARPYECTKCGKFFSHKSSLVKHQRVHTGARSYVCTKCGHAFSCKDTLVQHQIIH
TGVRPYECSQCGKAFSRKDTLVKHQKIHTGERPYECSECGKLFRHSSNLIVHQRIHTGAK
PYECSECGKCFSHNSSLILHQRVHTGARPYVCSECGKSYISSSHLVQHKKVHTGARPYEC
AECGKFFSRNFSLLLHQRVHTGERPYVCDACGKAYSRSSHLVRHHRVHRGERPHTCSFSD
P
Download sequence
Identical sequences G5C8H9
HGL_H00000375586-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]