SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000375690 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000375690
Domain Number 1 Region: 175-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 9e-49
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 649-745
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-20
Family PDZ domain 0.00000498
Further Details:      
 
Domain Number 3 Region: 540-615
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1172-1235
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000386
Family SAM (sterile alpha motif) domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000375690
Sequence length 1239
Comment SHANK1 (Homo_sapiens) SH3 and multiple ankyrin repeat domains 1
Sequence
MTHSPATSEDEERHSASECPEGGSASDSSPDGPGRGLRGTRGQGSGAPGNLASARGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNSGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGPSPSGAPGPTSGPQVQSQPSAPSTK
LSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQEGKQESRSDKAKRLFRHYTVGSYDSFDAPSDYIIKEKTVLLQKR
DSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQN
VVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKAPQQAKRLPPPAISLRSKSM
TSELEEMEYEQPPTPVPSMEKKRTVYQMALNKLDEILAGAQQTISASESPAPGGLASLGK
HRPKGFFATESSFDPHHRSQPSYERPSFLPPGPGLMLRQKSIAHDSLEAPRPGAGGSRRP
STRPVEPEVPPVPLPAAASLPRKLLPWEEGPGPPPPPLSGPLSQPQASALATVKASIISE
LSSKLQQFGGSSAAGGALPWARGGSGGTGDSHHGGAGYVPERTSSLQRQSGLLSSRETAE
PRRQELAACDQKRSGVSPSATAPPGAISPSASSSSTSSRHLQGVEFEMRPPLLRRAPSPS
LLPASEHKVSPAPRPSSLPILPSGPLYPGLFDIRGSPTGGAGGSADPFAPVFVPPHAGMS
GGLGGALSGASRSLSPTRLLSLPPDKPFGAKPLGFWTKFDVADWLEWLGLAEHRARFLDH
EIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALKFFLER
Download sequence
Identical sequences G5B8T5
HGL_H00000375690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]