SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000376010 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000376010
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-26
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.79e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.07e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000721
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000376010
Sequence length 412
Comment ZNF566 (Homo_sapiens) zinc finger protein 566
Sequence
MMFSDVSIDFSQEEWECLTDDQRDLYRDVMLENYSNLVSMAGLCISKPNVISYLEQGKEP
WLVDRELRRAQWPESRYETKKLFLKKEIYEIESAQWEVMGRLTRHDLQCSSFRDDWECHG
QFEKQHGSQERQFSELIITHEDVTTFSQHPSLTLQQIINNKEKYCATKEYRKSFRHVSQF
TTHQIIHTIEKPYECKECGKAFRHPSRLAHHQKIHTGKKPFECKECGKTFICGSDLTRHH
RIHTGEKPYECKECGKAFSSGSNFTRHQRIHTGEKPYECKECGKAFSSGSNFTQHQRIHT
GEKPYECKECGNAFSQSSQLIKHQRIHTGEKPYECKECEKAFRSGSDLTRHQRIHTGEKP
YQCKICGKAYSQSSQLISHHRIHAGEKPYEYRECGKNFNYDSQLIQHQNLYW
Download sequence
Identical sequences G5BWF0
HGL_H00000376010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]